Recombinant Human Galectin-1/LGALS1

Instruction Manual!

Product name:	Recombinant Human Galectin-1/LGALS1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM NaCl, 2mM DTT, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Galectin-1 is produced by our E.coli expression system and the target gene encoding Ala2-Asp135 is expressed with a 6His tag at the C-terminus.
Names	Galectin-1, Gal-1, 14 kDa Laminin-Binding Protein, HLBP14, 14 kDa Lectin, Beta-Galactoside-Binding Lectin L-14-I, Galaptin, HBL, HPL, Lactose-Binding Lectin 1, Lectin Galactoside-Binding Soluble 1, Putative MAPK-Activating Protein PM12, S-Lac Lectin 1, LGALS1
Accession #	P09382
Formulation	Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM NaCl, 2mM DTT, pH 7.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	Measured by its ability to agglutinate human red blood cells.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDG GAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKC VAFDLEHHHHHH
Background	Galectin-1 is a member of growing family of evolutionary conserved animal lectins. Galectin-1 is widely expressed in many cells and tissues. Galectins consists of a Galectin domain and two Beta-galactoside binding domains. Galectin-1 can binds LGALS3BP and interacts with CD2, CD3, CD4, CD7, CD43 and CD45. Galectin-1 may act as an autocrine negative growth factor which regulates apoptosis, cell proliferation and cell differentiation. In addition, Galectin-1 plays improtant roles in immunosuppressive and antiinflammatory properties.