elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1

Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1

Instruction Manual!

Product name: Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human PINX1 is produced by our E.coli expression system and the target gene encoding Met1-Lys328 is expressed with a 6His tag at the N-terminus.
Names PIN2/TERF1-Interacting Telomerase Inhibitor 1, Liver-Related Putative Tumor Suppressor, Pin2-Interacting Protein X1, Protein 67-11-3, TRF1-Interacting Protein 1, PINX1, LPTL, LPTS
Accession # Q96BK5
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGL GAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKS FSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSA FTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKP ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKP VEIAEDATLEETLVKKKKKKDSK
Background PIN2/TERF1-Interacting Telomerase Inhibitor 1 (PINX1) belongs to the PINX1 family . PINX1 contains a G-patch domain and a Telomerase Inhibiting Domain that is capable of binding MCRS1, TERT and TERF1. PINX1 is a widely expressed protein that localizes to nucleoli and telomere speckles. PINX1 can mediate TRF1 and TERT accumulation in nucleolus and enhance TRF1 binding to telomeres. PINX1 is recruited to chromosome periphery by Nucleolin, the complex is necessary for faithful chromosome congression. In addition, PINX1 may inhibit cell proliferation and act as tumor suppressor.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese