Recombinant Human Zinc Finger Protein 100/ZNF100

Instruction Manual!

Product name:	Recombinant Human Zinc Finger Protein 100/ZNF100
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, 1mM ZnCl2, 30% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Zinc Finger Protein 100 is produced by our E.coli expression system and the target gene encoding Met1-Lys109 is expressed with a 6His tag at the N-terminus.
Names	Zinc Finger Protein 100, ZNF100
Accession #	Q8IYN0
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, 1mM ZnCl2, 30% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMRHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDN LQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
Background	Zinc Finger Protein 100 (ZNF100) is part of the krueppel C2H2-type zinc-finger protein family. ZNF100 contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 is a DNA-binding protein domain consisting of zinc fingers. Zinc finger protein 100 occurs in nature as the part of transcription factors conferring DNA sequence specificity as the DNA-binding domain. Zinc finger proteins have also found use in protein engineering due to their modularity and have prospects as components of tools for use in therapeutic gene modulation and zinc finger nucleases.