Recombinant Human Calcineurin Subunit B1/CNB1

Instruction Manual!

Product name:	Recombinant Human Calcineurin Subunit B1/CNB1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Calcineurin Subunit B1 is produced by our E.coli expression system and the target gene encoding Met1-Val170 is expressed with a 6His tag at the N-terminus.
Names	Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B Alpha Osoform 1, PPP3R1, CNA2, CNB
Accession #	P63098
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, pH 8.0 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNG ELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Background	Calcineurin Subunit B Type 1 belongs to the calcineurin regulatory subunit family. Calcineurin Subunit B Type 1 is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase. It is composed of a catalytic subunit (A) and a regulatory subunit (B). It contains four EF-hand domains and four functional calcium-binding sites. Calcineurin Subunit B Type 1 plays an improtant role in the T cell activation pathway.