Recombinant Human Partner of Y14 and Mago/WIBG /PYM

Instruction Manual!

Product name:	Recombinant Human Partner of Y14 and Mago/WIBG /PYM
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Partner of Y14 and Mago is produced by our E.coli expression system and the target gene encoding Met1-Leu204 is expressed with a 6His tag at the C-terminus.
Names	Partner of Y14 and Mago, Protein Wibg Homolog, WIBG, PYM
Accession #	Q9BRP8
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSP EATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQG SRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEE ELEDLELGLLEHHHHHH
Background	Partner of Y14 and Mago (WIBG) is a key regulator of the Exon Junction Complex (EJC). EJC is a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs, is a positional landmarker for the intron exon structure of genes, and directs post-transcriptional processes in the cytoplasm, for instance mRNA export, nonsense-mediated mRNA decay or translation. WIBG is a cytoplasmic RNA-binding protein, it can be excluded from nucleus by Crm1. WIBG as a cooperateing partner of Mago-14, relates with Mago-14 by its N-terminal domain.