Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1
| Product name: | Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human Glutathione S-Transferase Zeta 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala216 is expressed with a 6His tag at the C-terminus. |
| Names | Maleylacetoacetate Isomerase, MAAI, GSTZ1-1, Glutathione S-Transferase Zeta 1, GSTZ1 |
| Accession # | O43708 |
| Formulation | Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKID GITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW AQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLV LEAFQVSHPCRQPDTPTELRALEHHHHHH
|
| Background | Maleylacetoacetate Isomerase (MAAI) belongs to the Glutathione S-Transferase super-family. MAAI encodes multifunctional enzymes in the detoxification of electrophilic molecules by conjugation with glutathione, for example, mutagens, carcinogens and several therapeutic drugs. MAAI is a bifunctional protein with low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. MAAI can catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. But it has minimal glutathione-conjugating activity with 7-chloro-4-nitrobenz-2-oxa-1, ethacrynic acid 3-diazole and maleylacetoacetate isomerase activity. |












