Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase

Instruction Manual!

Product name:	Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Inosine Triphosphate Pyrophosphatase is produced by our E.coli expression system and the target gene encoding Ala2-Ala194 is expressed with a 6His tag at the C-terminus.
Names	Inosine Triphosphate Pyrophosphatase, ITPase, Inosine Triphosphatase, Non-Canonical Purine NTP Pyrophosphatase, Non-Standard Purine NTP Pyrophosphatase, Nucleoside-Triphosphate Diphosphatase, Nucleoside-Triphosphate Pyrophosphatase, NTPase, Putative Oncogene Protein hlc14-06-p, ITPA, C20orf37
Accession #	Q9BY32
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQ GPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVR LFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAAL EHHHHHH
Background	Inosine Triphosphate Pyrophosphatase (ITPase) is a cytoplasmic enzyme that belongs to the HAM1 NTPase family. ITPase hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP) and deoxyinosine triphosphate (dITP) to the monophosphate nucleotide (IMP) and diphosphate. The ITPase enzyme acts as a homodimer and does not distinguish between the deoxy- and ribose forms. ITPase probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions. Defects in ITPase is thought to be inherited and is characterized by an over-accumulation of ITP in erythocytes, leukocytes and fibroblasts.