elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX

Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX

Instruction Manual!

Product name: Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Mortality Factor 4-Like Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a 6His tag at the C-terminus.
Names Mortality Factor 4-Like Protein 2, MORF-Related Gene X Protein, Protein MSL3-2, Transcription Factor-Like Protein MRGX, MORF4L2, KIAA0026, MRGX
Accession # Q15014
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAE NPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELK PWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLG TQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFL KYLAKNSASLFTASDYKVASAEYHRKALLEHHHHHH
Background Mortality Factor 4-Like Protein 2 (MORF4L2) is a member of the mortality factor (MORF) family. MORF4L2 localizes in the nucleus, possessing a protein kinase C phosphorylation site and a tyrosine phosphorylation site. MORF4L2 interacts with the Rb tumor suppressor and it has histone deacetylase activity which can either repress or promote the activity of the B-Myb promoter depending on the tissue. In addition, MORF4L2 is involved in cell growth, regulation, and senescence.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese