elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2

Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2 Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2

Instruction Manual!

Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2 is produced by our E.coli expression system and the target gene encoding Glu124-Arg224 is expressed with a GST tag at the N-terminus.
Names Ubiquitin-Conjugating Enzyme E2 J2, Non-Canonical Ubiquitin-Conjugating Enzyme 2, NCUBE-2, UBE2J2, NCUBE2
Accession # Q8N2K1
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMEKGPTLGSIETSDFTKRQLAVQSLAFNLK DKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLA GLQQANR
Background Ubiquitin-Conjugating Enzyme E2 J2 (UBE2J2) belongs to the ubiquitin-conjugating enzyme family. UBE2J2 is involved in the ubiquitiantion. UBE2J2 located in the membrane of the endoplasmic reticulum, catalyzes the covalent attachment of ubiquitin to other proteins. UBE2J2 may play a important role in the selective degradation of misfolded membrane protein from the endoplasmic reticulum.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese