elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2/UBE2G2/UBC7

Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2/UBE2G2/UBC7 Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2/UBE2G2/UBC7

Instruction Manual!

Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2/UBE2G2/UBC7
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2 is produced by our E.coli expression system and the target gene encoding Met1-Leu165 is expressed with a GST tag at the N-terminus.
Names Ubiquitin-Conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-Protein Ligase G2, UBE2G2
Accession # P60604
Formulation Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAGTALKRLMAEYKQLTLNPPEGIVAGPMNEEN FFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGD DPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSL GL
Background Ubiquitin-Conjugating Enzyme E2 G2 (UBE2G2) is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation, which belong to the ubiquitin-conjugating enzyme family. It shares 60% and 100% sequence identity with S.cerevisiae Ubc7 and mouse respectively. The UBE2G2 enzyme and the GP78 E3 ligase are active components of endoplasmic reticulum-associated degradation pathway which is essential for the degradation of misfolded ER proteins. The mechanism of K48-linked poly-ubiquitination by UBE2G2/GP78 appears to involve the transfer of preassembled Ub chains from UBE2G2 to lysine residues in a substrate. The E2 and E3 enzymes form a large hetero-oligomer which brings multiple UBE2G2 molecules into close proximity which allows for Ub transfer between neighboring E2s.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese