Recombinant Human Peroxiredoxin-6/PRDX6

Instruction Manual!

Product name:	Recombinant Human Peroxiredoxin-6/PRDX6
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Peroxiredoxin-6 is produced by our E.coli expression system and the target gene encoding Met1-Pro224 is expressed with a 6His tag at the N-terminus.
Names	Peroxiredoxin-6, 1-Cys Peroxiredoxin, 1-Cys PRX, 24 kDa Protein, Acidic Calcium-Independent Phospholipase A2, aiPLA2, Antioxidant Protein 2, Liver 2D PAGE Spot 40, Non-Selenium Glutathione Peroxidase, NSGPx, Red Blood Cells Page Spot 12, PRDX6, AOP2, KIAA0106
Accession #	P30041
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTP VCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNREL AILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRV ATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Background	Peroxiredoxin 6 belongs to the thiol-specific antioxidant protein family, which is a bifunctional enzyme with two distinct active sites. Peroxiredoxin 6 is involved in redox regulation of the cell and can reduce Hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. Peroxiredoxin 6 may regulates phospholipid turnover and protectes against oxidative injury. Peroxiredoxin 6 eases the oxidative stress and TGF-beta-induced abnormalities of human trabecular meshwork cells, it is necessary for blood vessel integrity in injured skin.