Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2/BDH2/DHRS6

Instruction Manual!

Product name:	Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2/BDH2/DHRS6
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human DHRS6 is produced by our E.coli expression system and the target gene encoding Met1-Leu245 is expressed with a 6His tag at the N-terminus.
Names	3-Hydroxybutyrate Dehydrogenase Type 2, Dehydrogenase/Reductase SDR Family Member 6, Oxidoreductase UCPA, R-Beta-Hydroxybutyrate Dehydrogenase, BDH2, DHRS6
Accession #	Q9BUT1
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQE LEKYPGIQTRVLDVTKKKQIDQFASEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMY LMIKAFLPKMLAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCV CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID GGWSL
Background	3-Hydroxybutyrate Dehydrogenase Type 2 belongs to the short-chain dehydrogenases/reductases (SDR) family. 3-Hydroxybutyrate Dehydrogenase Type 2 may play an important role in the peripheral utilization of 3-hydroxybutyrate. The cytoplasmic localization with its high ratio of oxidized NAD+, the NAD+ dependence and the kinetic parameters of 3-Hydroxybutyrate Dehydrogenase Type 2 make it suitable to conbert high levels of circulating 3-hydroxybutyrate into acetoacetate.