Recombinant Human Thioredoxin Domain-Containing Protein 12/TXNDC12/ERp18

Instruction Manual!

Product name:	Recombinant Human Thioredoxin Domain-Containing Protein 12/TXNDC12/ERp18
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human TXNDC12 is produced by our Mammalian expression system and the target gene encoding His27-Leu168 is expressed with a 6His tag at the C-terminus.
Names	Thioredoxin Domain-Containing Protein 12, Endoplasmic Reticulum Resident Protein 18, ER Protein 18, ERp18, Endoplasmic Reticulum Resident Protein 19, ER Protein 19, ERp19, Thioredoxin-Like Protein p19, hTLP19, TXNDC12, TLP19
Accession #	O95881
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVM VNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQE RLTGDAFRKKHLVDHHHHHH
Background	Thioredoxin Domain-Containing Protein 12 belongs to the thioredoxin superfamily. In this family, proteins possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors. TXNDC12 is widely expressed in many tissues and contains one thioredoxin domain.