Recombinant Human Protein Kinase C-Binding Protein NELL1
Product name: | Recombinant Human Protein Kinase C-Binding Protein NELL1 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human NELL1 is produced by our Mammalian expression system and the target gene encoding Arg17-Asn810 is expressed with a 6His tag at the C-terminus. |
Names | Protein Kinase C-Binding Protein NELL1, NEL-Like Protein 1, Nel-Related Protein 1, NELL1, NRP1 |
Accession # | Q92832 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
RTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAAPHVSEKLIQLF QNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEALPYRMAD GQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKIIF MPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVS GLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKV LAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSE CKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDD FSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCV CPSGFTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECA LRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCKDGKIFC RRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLTCP NLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDSYGVSRLSGSVWTMAGSPCTTCKCKNG RVCCSVDFECLQNNLDHHHHHH
|
Background | Protein Kinase C-Binding Protein NELL1 is a member of EGF-like domain containing family. NELL1 is a secreted protein and contains six EGF-like domains, one TSP N-terminal (TSPN) domain and five VWFC domains. NELL1 exists as a homotrimer which may be involved in cell growth regulation and differentiation. It is reported that NELL1 enhances new blood vessel formation (angiogenesis) and controls inflammation, which are critical elements in treating severe radiation dermatitis, skeletal muscle wounds, cardiac tissue damaged by acute myocardial infarction (AMI), or heart attack. |