Recombinant Human Cyclin-Dependent Kinase 7/CDK7

Instruction Manual!

Product name:	Recombinant Human Cyclin-Dependent Kinase 7/CDK7
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM PB,100mM NaCl,5mM DTT,20%Glycerol pH7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E.coli expression system and the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus.
Names	Cyclin-Dependent Kinase 7, 39 kDa Protein Kinase, p39 Mo15, CDK-Activating Kinase 1, Cell Division Protein Kinase 7, Serine/Threonine-Protein Kinase 1, TFIIH Basal Transcription Factor Complex Kinase Subunit, CDK7, CAK, CAK1, CDKN7, MO15, STK1
Accession #	P50613
Formulation	Supplied as a 0.2 μm filtered solution of 50mM PB,100mM NaCl,5mM DTT,20%Glycerol pH7.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKL GHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLT PSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVT RWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGC QLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Background	Cyclin-dependent kinase 7 (CDK7) belongs to the CMGC Ser/Thr superfamily, CDK7 colocalizes with PRKCI in the cytoplasm and nucleus, translocating from the nucleus to cytoplasm and perinuclear region in response to DNA-bound peptides. As a serine/threonine kinase CDK7 is involved in cell cycle control and RNA polymerase II-mediated RNA transcription. In addition, CDK7 is the catalytic subunit of the CDK-activating kinase complex, which phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11.