Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase/4HPPD/HPPDase

Instruction Manual!

Product name:	Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase/4HPPD/HPPDase
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, 0.1mM PMSF, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase is produced by our E.coli expression system and the target gene encoding Met1-Met393 is expressed with a 6His tag at the N-terminus.
Names	4-Hydroxyphenylpyruvate Dioxygenase, 4-Hydroxyphenylpyruvic Acid Oxidase, 4HPPD, HPD, HPPDase, HPD, PPD
Accession #	P32754
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, 0.1mM PMSF, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPL AYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKA RERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPK CSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKT AKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKA FEEEQNLRGNLTNMETNGVVPGM
Background	4-Hydroxyphenylpyruvate Dioxygenase (4HPPD) belongs to the 4HPPD family. 4HPPD is a key enzyme in the degradation of tyrosine, which catalyzes the second reaction in the catabolism of tyrosine the conversation of 4-hydroxyphenylpyruvate to homogentisate. 4HPPD exists in homodimer forms, which uses zinc as a cofactor to catalyze the third step in the conversion of L-phenylalanine to fumarate and acetoacetic acid. When the active 4HPPD enzyme concentration is low in the human body, it results in high levels of tyrosine concentration in the blood, which can cause mild mental retardation at birth, and degradation in vision as a patient grows older.