Recombinant Human Karyopherin Subunit α-2 /KPNA2/IPOA1

Instruction Manual!

Product name:	Recombinant Human Karyopherin Subunit α-2 /KPNA2/IPOA1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,1mM DTT,20% Glycerol, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Importin alpha 2 is produced by our E.coli expression system and the target gene encoding Met1-Phe529 is expressed with a 6His tag at the N-terminus.
Names	Importin Subunit Alpha-2, Karyopherin Subunit Alpha-2, RAG Cohort Protein 1, SRP1-Alpha, KPNA2, RCH1, SRP1
Accession #	P52292
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,1mM DTT,20% Glycerol, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDD QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKVVVDGGAIPAFISLLASPH AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK IILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEE EEDQNVVPETTSEGYTFQVQDGAPGTFNF
Background	Karyopherin Subunit α-2 (KPNA2) belongs to the importin alpha family. KPNA2 is widely expressed in many tissues and contains an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. KPNA2 interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. KPNA2 functions in nuclear protein importantly as an adapter protein for nuclear receptor KPNB1.