elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Serpin B6/Placental Thrombin Inhibitor

Recombinant Human Serpin B6/Placental Thrombin Inhibitor Recombinant Human Serpin B6/Placental Thrombin Inhibitor

Instruction Manual!

Product name: Recombinant Human Serpin B6/Placental Thrombin Inhibitor
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Serpin B6/placental thrombin inhibitor is produced by our E.coli expression system and the target gene encoding Met1-Pro376 is expressed with a Trx, 6His tag at the N-terminus.
Names Serpin B6, Cytoplasmic Antiproteinase, CAP, Peptidase Inhibitor 6, PI-6, Placental Thrombin Inhibitor, SERPINB6, PI6, PTI
Accession # P35237
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFHMDVLAEANGTFALNLLKTLGKDNSKNV FFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRVAN RLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDP LTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLP YVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLR NLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCAD HPFLFFIQHSKTNGILFCGRFSSP
Background Serpin B6 belongs to the serpin family. Serpin B6 localizes to the cytoplasm. Serpin B6 is expressed in many tissues, abundantly by mast cells in different tissues and mastocytoma lesions. Serpin B6 may be involved in the regulation of serine proteinases present in the brain or extravasated from the blood. In addition, Serpin B6 may play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese