Recombinant Human Cyclin-Dependent Kinase Inhibitor 1/CDKN1A/p21

Instruction Manual!

Product name:	Recombinant Human Cyclin-Dependent Kinase Inhibitor 1/CDKN1A/p21
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human p21 Cyclin Dependent Kinase 4 Inhibitor 1A is produced by our E.coli expression system and the target gene encoding Ser2-Pro164 is expressed with a 6His tag at the C-terminus.
Names	Cyclin-Dependent Kinase Inhibitor 1, CDK-Interacting Protein 1, Melanoma Differentiation-Associated Protein 6, MDA-6, p21, CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1
Accession #	P38936
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SEPAGDVRQNPCGSKACRRLFGPVDSEQLRRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWE RVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSP GGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKPLEHHHHHH
Background	Cyclin-Dependent Kinase Inhibitor 1 (CDKN1A) is a member of the CDI family. CDKN1A is widely expressed in all adult tissues, but low expressed in the brain tissue. CDKN1A can be induced by p53/TP53, mezerein and IFNB1, repressed by HDAC1. CDKN1A may be an important intermediate, by which p53/TP53 mediates its role as an inhibitor of cellular proliferation in response to DNA damage, CDKN1A can bind to and inhibit cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression.