Recombinant Human Protein Phosphatase 1C Catalytic Subunit/PPP1CC

Instruction Manual!

Product name:	Recombinant Human Protein Phosphatase 1C Catalytic Subunit/PPP1CC
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Greater than 95% as determined by reducing SDS-PAGE.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
Names	Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit, PP-1G, Protein Phosphatase 1C Catalytic Subunit, PPP1CC
Accession #	P36873
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREI FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAY KIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGG LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPN ATRPVTPPRGMITKQAKKLEHHHHHH
Background	Serine/Threonine-Protein Phosphatase PP1-Υ Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.