Recombinant Human Selenocysteine Lyase/SCLY

Instruction Manual!

Product name:	Recombinant Human Selenocysteine Lyase/SCLY
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Selenocysteine Lyase is produced by our E.coli expression system and the target gene encoding Met1-Ala445 is expressed with a 6His tag at the N-terminus.
Names	Selenocysteine Lyase, hSCL, SCLY, SCL
Accession #	Q96I15
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPE VIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSV VKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQT EVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTPMIAGL GKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQG HVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLK QAVAQLEDQA
Background	Selenocysteine Lyase belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. Selenocysteine Lyase exists as a homodimer in the cytosol. In the brain, Selenocysteine Lyase is as an enzyme that putatively salvages Sec and recycles the selenium for selenoprotein translation. Selenocysteine Lyase catalyzes the decomposition of L-selenocysteine to L-alanine and elemental selenium. Selenocysteine Lyase can be up-regulated In acute glomerulonephritis, it can also be regulated by JUN/AP-1.