Recombinant Human BCAS2/DAM1

Instruction Manual!

Product name:	Recombinant Human BCAS2/DAM1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 2mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human BCAS2 is produced by our E.coli expression system and the target gene encoding Ala2-Phe225 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus.
Names	Pre-mRNA-Splicing Factor SPF27, Breast Carcinoma-Amplified Sequence 2, DNA Amplified in Mammary Carcinoma 1 Protein, Spliceosome-Associated Protein SPF 27, BCAS2, DAM1
Accession #	O75934
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 2mM DTT, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MASMTGGQQMGRGSMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS YLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEH QAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREM ESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDFLEHHHHHH
Background	Breast Carcinoma-Amplified Sequence 2 (BCAS2) is a member of the SPF27 family. BCAS2 is a nuclear protein and widely expressed in many rtissues. BCAS2 is identified as being overexpressed in various breast cancer cell lines. BCAS2 is a component of the spliceosome, taking part in the removal of introns from mRNA precursors. BCAS2 interacts with estrogen receptor alpha and beta, thyroid hormone receptor beta, peroxisome proliferator-activated receptor gamma. BCAS2 functions as an ER co-activator and is capable of enhancing ER-mediated transcription.