Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH/ARH1

Instruction Manual!

Product name:	Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH/ARH1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human ADP-Ribosylarginine Hydrolase is produced by our E.coli expression system and the target gene encoding Met1-Leu357 is expressed with a 6His tag at the N-terminus.
Names	[Protein ADP-Ribosylarginine] Hydrolase, ADP-Ribosylarginine Hydrolase, ADP-Ribose-L-Arginine Cleaving Enzyme, ADPRH, ARH1
Accession #	P54922
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDA LDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQL KPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALAS ALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE SAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDS TAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Background	ADP-Ribosylarginine Hydrolase (ADPRH) belongs to the ADP-Ribosylglycohydrolase family. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-Ribosylation cycle, which is a post-translation modification that includes the addition of one or more ADP-ribose moieties. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis. In addition, ADPRH binds with magnesium ion and possess ADP-ribosylarginine hydrolase activity.