Recombinant Human Apolipoprotein D/ApoD

Instruction Manual!

Product name:	Recombinant Human Apolipoprotein D/ApoD
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Apolipoprotein D is produced by our Mammalian expression system and the target gene encoding Glu21-Ser189 is expressed with a 6His tag at the C-terminus.
Names	Apolipoprotein D, Apo-D, ApoD, APOD
Accession #	P05090
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADG TVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILA RNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSVDHHHHHH
Background	Apolipoprotein-D (ApoD) is an atypical apolipoprotein and, based on its primary structure, it also a member of the lipocalin family. ApoD is mainly associated with high density lipoproteins in human plasma. ApoD is expressed in numerous tissues having high levels of expression in spleen, testes and brain. ApoD plays a role in maintenance and repair within the central and peripheral nervous systems. ApoD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is a multi-ligand, multi-functional transporter and transports a ligand from 1 cell to another. ApoD is probably involved in the transport and binding of bilin, it appears to be able to transport a variety of ligands in a number of different contexts.