Recombinant Human CEACAM8/CD66b

Instruction Manual!

Product name:	Recombinant Human CEACAM8/CD66b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CEACAM8 is produced by our Mammalian expression system and the target gene encoding Gln35-His141 is expressed with a 6His tag at the C-terminus.
Names	Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8, CD67 Antigen, Carcinoembryonic Antigen CGM6, Non-Specific Cross-Reacting Antigen NCA-95, CD66b, CEACAM8, CGM6
Accession #	P31997
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRE TIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHVDHHHHHH
Background	Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen(CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.