elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Vanin-2/VNN2

Recombinant Human Vanin-2/VNN2 Recombinant Human Vanin-2/VNN2

Instruction Manual!

Product name: Recombinant Human Vanin-2/VNN2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Vascular Non-Inflammatory Molecule 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ser492 is expressed with a 6His tag at the C-terminus.
Names Vascular Non-Inflammatory Molecule 2, Vanin-2, Glycosylphosphatidyl Inositol-Anchored Protein GPI-80, Protein FOAP-4, VNN2
Accession # O95498
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWK FTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDST CPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFY DPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAP NGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFN FTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTMLKCKTTNL TTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTV SLFGRWYTKDSLYSSVDHHHHHH
Background Vascular Non-Inflammatory Molecule 2 (VNN2) is a member of the CN hydrolase family. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. they possess pantetheinase activity, which may play a role in oxidative-stress response. VNN2 is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. VNN2 involved in the thymus homing of bone marrow cells. In addition, VNN2 may regulate beta-2 integrin-mediated cell adhesion, migration and motility of neutrophil.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese