elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Zymogen Granule Membrane Protein 16/ZG16

Recombinant Human Zymogen Granule Membrane Protein 16/ZG16 Recombinant Human Zymogen Granule Membrane Protein 16/ZG16

Instruction Manual!

Product name: Recombinant Human Zymogen Granule Membrane Protein 16/ZG16
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Zymogen Granule Membrane Protein 16 is produced by our Mammalian expression system and the target gene encoding Asn17-Cys167 is expressed with a 6His tag at the C-terminus.
Names Zymogen Granule Membrane Protein 16, Zymogen Granule Protein 16, hZG16, Secretory Lectin ZG16, ZG16
Accession # O60844
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNG DLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRS GSLIDAIGLHWDVYPTSCSRCVDHHHHHH
Background Zymogen Granule Membrane Protein 16 (ZG16) belongs to the jacalin lectin family. ZG16 is highly expressed in liver and is detected at lower levels in colon, ileum and jejunum. ZG16 may play a role in protein trafficking. In addition, ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese