Recombinant Human Anterior Gradient Protein 3 Homolog/AG-3/BCMP11/AGR3

Instruction Manual!

Product name:	Recombinant Human Anterior Gradient Protein 3 Homolog/AG-3/BCMP11/AGR3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM EDTA, pH 8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Anterior Gradient Protein 3 Homolog is produced by our Mammalian expression system and the target gene encoding Ile22-Leu166 is expressed with a 6His tag at the C-terminus.
Names	Anterior Gradient Protein 3 Homolog, AG-3, AG3, hAG-3, Breast Cancer Membrane Protein 11, AGR3, BCMP11
Accession #	Q8TD06
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM EDTA, pH 8.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEE IQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLL IENMKKALRLIQSELVDHHHHHH
Background	Anterior Gradient Protein 2(AG-2) and Anterior Gradient Protein 3 (AG-3) are human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan (hAG-3 protein). AG-3 could serve as a prognostic marker for survival in patients with low grade and high grade serous ovarian carcinomas.