Recombinant Human Alkaline Phosphatase/ALPL

Instruction Manual!

Product name:	Recombinant Human Alkaline Phosphatase/ALPL
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM MgSO4, 0.1mM ZnCl2, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Alkaline Phosphatase is produced by our Mammalian expression system and the target gene encoding Leu18-Ser502 is expressed with a 6His tag at the C-terminus.
Names	Alkaline Phosphatase, Tissue-Nonspecific Isozyme, AP-TNAP, TNSALP, Alkaline Phosphatase Liver/Bone/Kidney Isozyme, ALPL
Accession #	P05186
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM MgSO4, 0.1mM ZnCl2, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	Special Activity: 66 U/mg based on useing p-nitrophenyl phosphate (pNPP) as a phosphatase substrate which turns yellow (λmax= 405 nm) when dephosphorylated by ALP. At pH10.4, 37⁰C, 1 Unit is defined as cleaving 1.0 µmol p-nitrophenyl phosphate (pNPP) per minute.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPG EETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEV TSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNI RDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLT LDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHE GKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDK KPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLH GVHEQNYVPHVMAYAACIGANLGHCAPASSVDHHHHHH
Background	Alkaline Phosphatase, Tissue-Nonspecific Isozyme (ALPL) is a cell membrane protein which belongs to the alkaline phosphatase family. There are at least four distinct but related alkaline phosphatases in humans: intestinal AP (IAP), placental AP(PLAP), germ cell AP (GCAP) and their genes are clustered on chromosome 2, tissue-nonspecific isozyme (TNAP) which gene is located on chromosome 1. Alkaline phosphatases (APs) are dimeric enzymes, it catalyze the hydrolysis of phosphomonoesters with release of inorganic phosphate. The native ALPL is a glycosylated homodimer attached to the membrane through a GPI-anchor. This isozyme may play a role in skeletal mineralization. Mutations in ALPL gene have been linked directly to different forms of hypophosphatasia,characterized by poorly mineralized cartilage and bones, and this disorder can vary depending on the specific mutation since this determines age of onset and severity of symptoms.