Recombinant Human Carbonic Anhydrase 4/CA4

Instruction Manual!

Product name:	Recombinant Human Carbonic Anhydrase 4/CA4
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Carbonic Anhydrase 4 is produced by our E.coli expression system and the target gene encoding Ala19-Lys283 is expressed with a 6His tag at the C-terminus.
Names	Carbonic Anhydrase 4, Carbonate Dehydratase IV, Carbonic Anhydrase IV, CA-IV, CA4
Accession #	P22748
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	Specific Activity is greater than 614.96pmol/min/ug
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWT VQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEK GTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEE KLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLG QRTVIKLEHHHHHH
Background	Carbonic Anhydrase 4 (CA4) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Carbonic anhydrase 4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Carbonic anhydrase 4 may stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It may have a role in inherited renal abnormalities of bicarbonate transport. Furthermore, Carbonic anhydrase 4 is essential for acid overload removal from the retina and retina epithelium and acid release in the choriocapillaris.