Recombinant Human C-X-C Motif Chemokine 11/CXCL11
| Product name: | Recombinant Human C-X-C Motif Chemokine 11/CXCL11 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 2.5mM EDTA, 500mM NaCl, pH 9.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E. coli |
| Description | Recombinant Human C-X-C Motif Chemokine 11 is produced by our E.coli expression system and the target gene encoding Phe22-Phe94 is expressed. |
| Names | C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon Gamma-Inducible Protein 9, IP-9, Interferon-Inducible T-Cell Alpha Chemoattractant, I-TAC, Small-Inducible Cytokine B11, CXCL11, ITAC, SCYB11, SCYB9B |
| Accession # | O14625 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 2.5mM EDTA, 500mM NaCl, pH 9.0. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLI IKKVERKNF
|
| Background | Chemokine Ligand 11 (CXCL11) is a non-ELR (lacking the Glu-Leu-Arg tripeptide motif) CXC chemokine. CXCL11 is highly expressed in peripheral blood leukocytes, pancreas and liver, with moderate levels in thymus, spleen and lung and low expression levels were in small intestine, placenta and prostate. Gene expression of CXCL11 is strongly induced by IFN-γ and IFN-β, and weakly induced by IFN-α. This chemokine elicits its effects on its target cells by interacting with the cell surface chemokine receptor CXCR3, with a higher affinity than do the other ligands for this receptor, CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. Its gene is located on human chromosome 4 along with many other members of the CXC chemokine family. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with humanCXCL11. In humans, CXCL11, IP-10 and MIG all map to the same locus on chromosome 4. |












