elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human β-Defensin 1/DEFB1

Recombinant Human β-Defensin 1/DEFB1 Recombinant Human β-Defensin 1/DEFB1

Instruction Manual!

Product name: Recombinant Human β-Defensin 1/DEFB1
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed.
Names Beta-Defensin 1, BD-1, hBD-1, Defensin Beta 1, DEFB1, BD1, HBD1
Accession # P60022
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Background β-Defensin 1 (DEFB1) is a member of the β-defensin family, which is highly expressed by epithelial cells. β-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. β-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in β-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. β-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, β-defensin 1 is associated with induction profiles in gingival keratinocytes.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese