Recombinant Human Neurotrophic Tyrosine Kinase Receptor Type 2/TrkB/NTRK2

Instruction Manual!

Product name:	Recombinant Human Neurotrophic Tyrosine Kinase Receptor Type 2/TrkB/NTRK2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human TrkB is produced by our Mammalian expression system and the target gene encoding Cys32-His430 is expressed with a 6His tag at the C-terminus.
Names	BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Trk-B, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-Related Kinase B, NTRK2, TRKB
Accession #	Q16620
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNL TIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKT LQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVP NMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITF LESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNN GDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTD VTDKTGREHVDHHHHHH
Background	The TRK Family of Tyrosine Kinase Receptor consists of 3 members: TrkA, TrkB and TrkC. The three TRK family proteins have different ligand specificities. They connect to different neurotrophins, including NGF, BDNF, NT-3NT-4/5. TRKA binds NGF, TRKB binds BDNF and NT-3, TRKC binds NT-4/5. At the protein sequence level, human and rat TRKB have greater than 90% sequence identity and the proteins exbihit cross-species activity. TRKB is primarily expressed in the nervous system and it also expression in a wide variety of tissues with low levels.