Recombinant Human Anterior Gradient Protein 2 Homolog/AG-2/HPC8/AGR2

Instruction Manual!

Product name:	Recombinant Human Anterior Gradient Protein 2 Homolog/AG-2/HPC8/AGR2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,10％Glycerol，pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Anterior Gradient Protein 2 Homolog is produced by our Mammalian expression system and the target gene encoding Arg21-Leu175 is expressed with a 6His tag at the C-terminus.
Names	Anterior Gradient Protein 2 Homolog, AG-2, hAG-2, HPC8, Secreted Cement Gland Protein XAG-2 Homolog, AGR2, AG2
Accession #	O95994
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,10％Glycerol，pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQ ALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY AYEPADTALLLDNMKKALKLLKTELVDHHHHHH
Background	Anterior Gradient 2 (AGR2) is an 18-21 kDa member of the PDI family of enzymes. AGR2 is widely expressed in secretory cells, such as small intestine goblet, prostate epithelium, enteroendocrine cells, and multiple carcinoma cell types. AGR2 forms transient disulfide linkages with molecules destined for secretion, possibly aiding protein folding. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor. Mature human AGR2 is 155 amino acids (aa) in length (aa 21 - 175). Cys81 is presumed to participate in intermolecular bond formation. Over aa 21 - 175, human AGR2 shares 94% aa identity with mouse AGR2.