Recombinant Human Adipocyte Adhesion Molecule/ASAM/CLMP/ACAM

Instruction Manual!

Product name:	Recombinant Human Adipocyte Adhesion Molecule/ASAM/CLMP/ACAM
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Adipocyte Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Thr19-Met233 is expressed with a 6His tag at the C-terminus.
Names	CXADR-Like Membrane Protein, Adipocyte Adhesion Molecule, Coxsackie- and Adenovirus Receptor-Like Membrane Protein, CAR-Like Membrane Protein, CLMP, ACAM, ASAM
Accession #	Q9H6B4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRV AFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSD LTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNE AGKESCVVRVTVQYVQSIGMVDHHHHHH
Background	Adipocyte Adhesion Molecule (ASAM) is a type I transmembrane protein and member of the CTX family within the immunoglobulin superfamily. ASAM may be involved in the cell-cell adhesion, play an important role in adipocyte differentiation and development of obesity. ASAM can be expressed in the skeletal, heart, colon, spleen, muscle, lung and kidney with high level, and in the peripheral blood leukocytes and liver with low level. The extracellular region of ASAM consists two potential N-linked glycosylation sites, and two immunoglobulin domains, one V-type and one C2-type.