Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1

Instruction Manual!

Product name:	Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human ASGPR1 is produced by our Mammalian expression system and the target gene encoding Gln62-Ile291 is expressed with a 6His tag at the C-terminus.
Names	Asialoglycoprotein Receptor 1, ASGP-R 1, ASGPR 1, C-Type Lectin Domain Family 4 Member H1, Hepatic Lectin H1, HL-1, ASGR1, CLEC4H1
Accession #	P07306
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLH VKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVV VTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCA HFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLVDHHHHHH
Background	Asialoglycoprotein Receptor 1 (ASGPR1) is an endocytic recycling receptor, belongs to the long-form subfamily of the C-type/Ca2+-dependent lectin family. ASGPR consists of two noncovalently-linked subnits, ASGPR1 and ASGPR2. ASGPR1 mediates the endocytosis of plasma glycoproteins, recognizes terminal galactose and N-acetylgalactosamine units. When the ligand binds to to ASGPR1, results in the complex is internalized and transported to a sorting organelle, then ASGPR1 and ligand can be disassociated, ASGPR1 returns to the cell membrane surface.