elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Zinc-α-2-Glycoprotein/AZGP1/ZAG

Recombinant Human Zinc-α-2-Glycoprotein/AZGP1/ZAG Recombinant Human Zinc-α-2-Glycoprotein/AZGP1/ZAG

Instruction Manual!

Product name: Recombinant Human Zinc-α-2-Glycoprotein/AZGP1/ZAG
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Zinc-alhpa-2-Glycoprotein is produced by our Mammalian expression system and the target gene encoding Gln21-Ser298 is expressed with a 6His tag at the C-terminus.
Names Zinc-Alpha-2-Glycoprotein, Zn-Alpha-2-GP, Zn-Alpha-2-Glycoprotein, AZGP1, ZAG, ZNGP1
Accession # P25311
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQ DSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDGKDYIEFNKE IPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQ APGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSC HVQHSSLAQPLVVPWEASVDHHHHHH
Background Zinc-α-2-Glycoprotein (AZGP1) can be found in blood plasma, seminal plasma, urine, sweat, saliva, liver, and epithelial cells of various human glands. AZGP1 has been proposed in the regulation of body weight, and the melanin production by normal and malignant melanocytes. AZGP1 stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 has been reported to stimulate lipid breakdown and may have an important role in lipid homeostasis. Mature human AZGP1 consists of one MHC class I antigen region and a C2-type Ig-like domain. AZGP1 has two alternate splice forms, one shows a 66 amino acids substitution for the C-terminal 30 amino acids, the other one shows a nine Lys substitution for amino acid 151-298.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese