Recombinant Human Cell Adhesion Molecule 3/CADM3/IGSF4B/SynCAM3

Instruction Manual!

Product name:	Recombinant Human Cell Adhesion Molecule 3/CADM3/IGSF4B/SynCAM3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cell Adhesion Molecule 3 is produced by our Mammalian expression system and the target gene encoding Asn25-His330 is expressed with a 6His tag at the C-terminus.
Names	Cell Adhesion Molecule 3, Brain Immunoglobulin Receptor, Immunoglobulin Superfamily Member 4B, IgSF4B, Nectin-Like Protein 1, NECL-1, Synaptic Cell Adhesion Molecule 3, SynCAM3, TSLC1-Like Protein 1, TSLL1, CADM3, IGSF4B, NECL1, SYNCAM3, TSLL1
Accession #	Q8N126
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTST PHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQS SGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGA DRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESAL IFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHVDHHHHHH
Background	Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin-like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.