Recombinant Human Cystatin SN/CST1

Instruction Manual!

Product name:	Recombinant Human Cystatin SN/CST1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cystatin SN is produced by our Mammalian expression system and the target gene encoding Trp21-Ser141 is expressed with a 6His tag at the C-terminus.
Names	Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1, CST1
Accession #	P01037
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFF DVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQESVDHHHHHH
Background	Cystatin-SN is a member of family 2 of the Cystatin superfamily and a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. Together with Cystatins S and SA, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin-SN inhibits members of the Papain family including Cathepsins B, C, H and L.