Recombinant Human Glycoprotein A33/GPA33/GPA33

Instruction Manual!

Product name:	Recombinant Human Glycoprotein A33/GPA33/GPA33
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Glycoprotein A33 is produced by our Mammalian expression system and the target gene encoding Ile22-Val235 is expressed with a 6His tag at the C-terminus.
Names	Cell Surface A33 Antigen, Glycoprotein A33, GPA33
Accession #	Q99795
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYK NRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGE TIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNE EGTQFCNITVAVRSPSMNVVDHHHHHH
Background	Human Glycoprotein A33 (GPA33) is a single-pass type I membrane protein, belongs to the CTX family of cell adhesion molecular within the immunoglobulin family, can be expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 consists of one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, a extracellular region and a intracellular tail. Intracellular traffic and recycling to the cell surface appear to play an important role in GPA33 function and to have an influence on its surface density superseding translation regulation. GPA33 has become a promising target of immunologic therapy strategies. GPA33 may also play a important role in cell-cell recognition and signaling.
References	Theranostic pretargeted radioimmunotherapy of colorectal cancer xenografts in mice using picomolar affinity 86Y- or 177Lu-DOTA-Bn binding scFv C825/GPA33 IgG bispecific immunoconjugates