Recombinant Human B7-H2/ICOSLG/CD275

Instruction Manual!

Product name:	Recombinant Human B7-H2/ICOSLG/CD275
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus.
Names	ICOS Ligand, B7 Homolog 2, B7-H2, B7-Like Protein Gl50, B7-Related Protein 1, B7RP-1, CD275, ICOSLG, B7H2, B7RP1, ICOSL, KIAA0653
Accession #	O75144
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNR ALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHS PSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNI GCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH
Background	Inducible Co-Stimulator Ligand (ICOSLG) belongs to the immunoglobulin superfamily. ICOSLG contains Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion, it also induces B-cell proliferation and differentiation into plasma cells. It could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. ICOSLG is widely expressed lymph nodes, leukocytes and spleen, detected on activated monocytes and dendritic cells.