Recombinant Human LAMP2/CD107b

Instruction Manual!

Product name:	Recombinant Human LAMP2/CD107b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LAMP2 is produced by our Mammalian expression system and the target gene encoding Leu29-Ile375 is expressed with a 6His tag at the C-terminus.
Names	Lysosome-Associated Membrane Glycoprotein 2, LAMP-2, Lysosome-Associated Membrane Protein 2, CD107 Antigen-Like Family Member B, CD107b, LAMP2
Accession #	P13473
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFG PGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLST LEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTY SVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAV KNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQ PFNVTQGKYSTAQECSLDDDTIVDHHHHHH
Background	Lysosomal Associated Membrane Protein 2 (LAMP2) is a major component of lysosomal membranes. LAMP2 is a transmembrane glycoprotein about 110kDa. Mature human LAMP2 consists of a 347 amino acid (aa) intralumenal domain, a 24 aa transmembrane segment, and a 35 aa cytoplasmic tail . The lumenal domain is organized into two heavily N-glycosylated regions. Alternate splicing generates a human LAMP2 isoform (LAMP2B) with a substituted juxtamembrane lumenal region, cytoplasmic tail and transmenmbrane segment.LAMP2 itself can cleavage lysosomal luminal domain and degradation lysosomal. In the help of chaperone HSC73,LAMP2 mediates the lysosomal uptake in complex with cargo proteins and is required for the lysosomal destruction of autophagic vacuoles.