Recombinant Human Ly6/PLAUR Domain-Containing Protein 3/LYPD3/C4.4A

Instruction Manual!

Product name:	Recombinant Human Ly6/PLAUR Domain-Containing Protein 3/LYPD3/C4.4A
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LYPD3 is produced by our Mammalian expression system and the target gene encoding Leu31-His286 is expressed with a 6His tag at the C-terminus.
Names	Ly6/PLAUR Domain-Containing Protein 3, GPI-Anchored Metastasis-Associated Protein C4.4A Homolog, Matrigel-Induced Gene C4 Protein, MIG-C4, LYPD3, C4.4A
Accession #	O95274
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLD LHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVS CYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDL RNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHH HHHH
Background	Ly6/PLAUR domain containing3 (LYPD-3) is a GPI-linked protein. The structure of LYPD-3 is similar to the urokinasetype plasminogen activator receptor (uPAR). LYPD-3 is a 6 -100 kDa molecule with variable cell type-specific N-O-linked glycosylation, mature human LYPD-3 contains two uPAR/Ly6 domains and a Ser/Thr/Pro-rich (STP) region includes a protease sensitive site . The interaction of LYPD-3 with Laminin 1 and 5 on neighboring cells promotes the adhesion, spreading, and migration of tumor cells. LYPD-3 additionally interacts with Galectin-3 and the anterior gradient proteins AG-2 and AG-3. LYPD-3 overexpression in non-small cell lung cancer is predictive of increased mortality.