elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Chymotrypsinogen B/CTRB1

Recombinant Human Chymotrypsinogen B/CTRB1 Recombinant Human Chymotrypsinogen B/CTRB1

Instruction Manual!

Product name: Recombinant Human Chymotrypsinogen B/CTRB1
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Chymotrypsinogen B is produced by our Mammalian expression system and the target gene encoding Cys19-Asn263 is expressed with a 6His tag at the C-terminus.
Names Chymotrypsinogen B, CTRB1, CTRB
Accession # P17538
Formulation Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDV VVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDF PAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDS GGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAANVDHHHHHH
Background Chymotrypsinogen B (CTRB1) is a 263 amino acid protein with signal peptide (1-18) and Chymotrypsinogen B (19-263). Chymotrypsinogen B have three chains:Chymotrypsin B chain A(19-31), Chymotrypsin B chain B(34-164), Chymotrypsin B chain C (167-263). Chymotrypsinogen B is a Serine Protease Hydrolase secrets into gastrointestinal tract as the inactive precursor Chymotrypsinogen.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese