elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Neuroplastin/NPTN

Recombinant Human Neuroplastin/NPTN Recombinant Human Neuroplastin/NPTN

Instruction Manual!

Product name: Recombinant Human Neuroplastin/NPTN
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Neuroplastin is produced by our Mammalian expression system and the target gene encoding Gln29-His220 is expressed with a 6His tag at the C-terminus.
Names Neuroplastin, Stromal Cell-Derived Receptor 1, SDR-1, NPTN, SDFR1, SDR1
Accession # Q9Y639
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPR AEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKK ENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDH HHHHH
Background Neuroplastin is a 52-57 kDa member of the Ig-superfamily. Neuroplastin likely serves as a cell adhesion molecule, and is widely expressed in multiple tissues. Human Neuroplastin is 282 amino acids in length. Human Neuroplastin is a type I transmembrane glycoprotein that contions two Ig-like domains (aa 32-119 and 122-213) and a 38 aa cytoplasmic region (aa 245-282).

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese