Recombinant Human β-Galactoside α-2,6-Sialyltransferase 1/ST6GAL1

Instruction Manual!

Product name:	Recombinant Human β-Galactoside α-2,6-Sialyltransferase 1/ST6GAL1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human ST6GAL1 is produced by our Mammalian expression system and the target gene encoding Lys27-Cys406 is expressed with a 6His tag at the C-terminus.
Names	Beta-Galactoside Alpha-2,6-Sialyltransferase 1, Alpha 2,6-ST 1, B-Cell Antigen CD75, CMP-N-Acetylneuraminate-Beta-Galactosamide-Alpha-2,6-Sialyltransferase 1, ST6Gal I, ST6GalI, Sialyltransferase 1, ST6GAL1, SIAT1
Accession #	P15907
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEA SFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVT DFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQ DVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRK LHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTD VCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH
Background	The ST6GAL1 gene encodes β-Galactosamide α-2,6-Sialyltransferase 1. It is a type II membrane protein and is localized to the trans-Golgi network. It catalyzes 2,6-sialylation of Galβ1,4-GlcNAc structures on N-glycans. ST6GAL1 is highly expressed in the liver and other tissues. ST6GAL1 deficiency causes abnormalities in B-cell immunoreactivity. The expression and activity of ST6GAL1 are associated with tumor metastasis in breast and colon cancers. The majority of ST6GAL1 in the liver is cleaved and secreted into the serum and may be used as a biomarker for hepatitis diseases.