Recombinant Human Regenerating Islet-Derived Protein 1-α/REG1A

Instruction Manual!

Product name:	Recombinant Human Regenerating Islet-Derived Protein 1-α/REG1A
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus.
Names	Lithostathine-1-Alpha, Islet Cells Regeneration Factor, ICRF, Islet of Langerhans Regenerating Protein, REG, Pancreatic Stone Protein, PSP, Pancreatic Thread Protein, PTP, Regenerating Islet-Derived Protein 1-Alpha, REG-1-Alpha, Regenerating Protein I Alpha, REG1A, PSPS, PSPS1, REG
Accession #	P05451
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASL IKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDV PCEDKFSFVCKFKNVDHHHHHH
Background	Regenerating Islet-Derived Protein 1-α (REG1A) belongs to the Reg family of secreted proteins with a C-type lectic domain. REG1A is highly expressed levels in fetal and infant brains, much lower in adult brains. REG1A promotes the maintenance and growth of pancreatic islet cells and intestinal villi. In addition to, REG1A Might act as an inhibitor of spontaneous calcium carbonate precipitation and be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.