Recombinant Human Serpin A7/TBG

Instruction Manual!

Product name:	Recombinant Human Serpin A7/TBG
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Serpin A7 is produced by our Mammalian expression system and the target gene encoding Ala21-Ala415 is expressed with a 6His tag at the C-terminus.
Names	Thyroxine-Binding Globulin, Serpin A7, T4-Binding Globulin, SERPINA7, TBG
Accession #	P05543
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGAC CSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDV KTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWANPFD PSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFVLPKEGQMESV EAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLK LSNAAHKAVLHIGEKGTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVV NPTEAVDHHHHHH
Background	Serpin A7 is a secreted protein which belongs to the Serpin family. As a 54 kDa protein, Serpin A7 is synthesized primarily in the liver and secreted in plasma. Genomically, Serpin A7 is a serpin, although it has no inhibitory function like many other members of this class of proteins. Serpin A7 binds thyroid hormone in circulation. It is one of three proteins (along with transthyretin and albumin) responsible for carrying the thyroid hormones thyroxine (T4) and 3,5,3’-triiodothyronine (T3) in the bloodstream. Of these three proteins, Serpin A7 has the highest affinity for T4 and T3, but is present in the lowest concentration. Despite its low concentration, Serpin A7 carries the majority of T4 in serum. Due to the very low serum concentration of T4 and T3 in the blood, Serpin A7 is rarely more than 25% saturated with its ligand. Unlike transthyretin and albumin, Serpin A7 has a single binding site for T4/T3. Serpin A7 tests are sometimes used in finding the reason for elevated or diminished levels of thyroid hormone, and defects in Serpin A7 are a cause of Serpin A7 deficiency.