Recombinant Human SLC3A2/MDU1/CD98
Product name: | Recombinant Human SLC3A2/MDU1/CD98 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human CD98 is produced by our Mammalian expression system and the target gene encoding Arg206-Ala630 is expressed with a 6His tag at the C-terminus. |
Names | 4F2 Cell-Surface Antigen Heavy Chain, 4F2hc, 4F2 Heavy Chain Antigen, Lymphocyte Activation Antigen 4F2 Large Subunit, CD98, SLC3A2, MDU1 |
Accession # | P08195 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKD DVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALE FWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLL TSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQR SKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADL LLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAAVDHHHHHH
|
Background | CD98 is a single-pass type I I membrane protein which belongs to the SLC3A transporter family. SLC3A2/MDU1 is expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. It consists of an 85 kDa glycosylated type II transmembrane heavy chain and a 40-50 kDa non-glycosylated light chain with 12 transmembrane segments. The heavy chain (SLC3A2) pairs with one of several light chains (SLC7A5, 6, 7, 8, 10, or 11) and is required for the cell surface expression and amino acid transport function of the light chains. It is involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. It also mediates integrin signaling, T cell costimulation, B cell proliferation, and viral fusion with cell membranes. |