Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2

Instruction Manual!

Product name:	Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus.
Names	V-Set and Immunoglobulin Domain-Containing Protein 2, Cortical Thymocyte-Like Protein, CT-Like Protein, VSIG2, CTH, CTXL
Accession #	Q96IQ7
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSK SKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQS GQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCV ATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH
Background	V-Set and Immunoglobulin Domain-Containing Protein 2 (VSIG2) is presumably a 50-60 kDa single-pass type I transmembrane (glyco)protein which contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. VSIG2 is highly expressed in the stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. V-set domains are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains, in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86, in myelin membrane adhesion molecules, in junction adhesion molecules (JAM), in tyrosine-protein kinase receptors, and in the programmed cell death protein 1 (PD1). It shows expression in stomach and prostate by Northern blot, and likely participates in cell adhesion. Human VSIG2 precursor is 327 amino acids in length.